Everything below concerns GHRH receptor. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-11-03. Numbers and descriptions here follow the published literature rather than marketing material.
Tesamorelin acts on the growth hormone-releasing hormone receptor, a G-protein-coupled receptor found on somatotroph cells in the anterior pituitary. Binding triggers a rise in intracellular cyclic AMP, which in turn opens ion channels and raises calcium concentrations, leading to release of stored growth hormone into the bloodstream. Because the peptide works through the same receptor as the body's own GHRH, the resulting secretion follows a pulsatile pattern rather than a continuous elevation. The N-terminal modification slows enzymatic breakdown, so the signal persists longer than it would with the unmodified hormone.
Growth hormone released from the pituitary stimulates the liver and other tissues to produce insulin-like growth factor 1, a stable circulating protein that serves as a practical marker of activity. Clinical studies therefore track IGF-1 concentrations alongside the hormone itself, and they commonly measure body composition with imaging rather than relying on body weight alone. Visceral adipose tissue, the fat surrounding abdominal organs, is quantified by computed tomography in the studies that supported approval. Adverse effects reported in trials include injection-site reactions, joint pain, and increases in blood glucose, which is why monitoring accompanies use.
Tesamorelin is a synthetic peptide that belongs to the growth hormone-releasing hormone family and contains the same forty-four amino acid sequence as endogenous GHRH, extended at the amino terminus by a trans-3-hexenoyl group. That small fatty acid modification protects the peptide from rapid cleavage by dipeptidyl peptidase-4, the enzyme that shortens the half-life of native GHRH to only a few minutes. Chemically the compound is produced by solid-phase peptide synthesis, purified by chromatography, and supplied as a sterile lyophilized powder for reconstitution.
Regulatory approval in the United States came in 2010, when the Food and Drug Administration cleared the peptide for the reduction of excess abdominal fat in adults with HIV infection and associated lipodystrophy. The decision rested mainly on two randomized phase 3 trials that enrolled roughly eight hundred patients and ran for twenty-six weeks. Participants receiving active drug showed substantially greater declines in visceral adipose tissue than those receiving placebo, while total body weight changed comparatively little. A reformulated presentation was later approved, and the product has remained a niche therapy rather than a general weight-loss agent.
| Property | Value | Notes |
|---|---|---|
| Receptor target | Growth hormone-releasing hormone receptor | G-protein-coupled receptor expressed on pituitary somatotroph cells |
| Primary signaling route | Cyclic AMP and protein kinase A | Increases intracellular calcium and promotes hormone release |
| Downstream marker | Insulin-like growth factor 1 | Blood concentration used as an integrated activity indicator |
| Study endpoint | Change in visceral adipose tissue | Assessed with computed tomography in trial populations |
| Research status | Investigational outside the approved indication | Trials in cognitive impairment did not meet primary endpoints |
Studies of the compound rely on imaging and laboratory endpoints rather than on symptoms alone. Visceral adipose tissue is usually quantified by computed tomography or magnetic resonance imaging at the level of the abdomen, with waist circumference serving as a cheaper but less specific proxy. Blood work tracks insulin-like growth factor 1, fasting glucose, glycated hemoglobin, and lipid fractions. In the pivotal trials the imaging endpoint fell by roughly fifteen to twenty percent over six months, subcutaneous fat changed little, and the visceral fat returned toward baseline after treatment stopped, a pattern that shapes how clinicians discuss durability.
Whether the drug improves hard clinical outcomes is not settled. No completed trial has shown a reduction in heart attacks or strokes among treated patients, although a dedicated cardiovascular outcomes study has been discussed in the literature. Investigators have also examined hepatic fat in people with HIV and fatty liver disease, cognitive measures in small cohorts, and changes in bone density. Regulatory labeling emphasizes monitoring of insulin-like growth factor 1 because supraphysiologic levels raise questions about tissue growth, and the clinical significance of that signal remains an open question rather than a demonstrated harm.
Tesamorelin is a synthetic analog of growth hormone-releasing hormone, a peptide hormone produced by the hypothalamus. The molecule retains the 44-amino-acid sequence of human GHRH and carries a trans-3-hexenoyl modification at its N-terminus. This modification increases resistance to enzymatic degradation and extends the peptide's functional stability relative to native GHRH. The compound is supplied as a lyophilized powder for reconstitution and subcutaneous administration in clinical settings. Its development code was TH9507, and it belongs to the GHRH analog class. It is not a growth hormone product; instead, it acts upstream to stimulate endogenous growth hormone release.
Clinical interest in tesamorelin arose from the need to address visceral adiposity in people living with HIV. Antiretroviral therapy improved survival but was associated in some patients with central fat accumulation, altered lipid profiles, and metabolic complications. This condition, often called HIV-associated lipodystrophy, involves excess visceral adipose tissue that is difficult to manage through diet and exercise alone. Investigators evaluated tesamorelin because GHRH analogs can stimulate growth hormone secretion and influence fat distribution without direct liposuction or invasive procedures.
A Phase 3 program led to regulatory approval in the United States in 2010 for reduction of excess visceral abdominal fat in adults with HIV and lipodystrophy. Subsequent studies examined effects on liver fat, muscle area, and metabolic markers, with mixed findings for some endpoints. Long-term cardiovascular outcomes and effects on mortality remain uncertain because most trials were relatively short and focused on imaging-based fat measurements. Use in populations without HIV has been studied experimentally but is not part of the approved indication.
In 1932, most of these uses were banned in the United States after a federal investigation into the health effects of radioactivity. 10,000 individuals in the United States had been injected with thorium during X-ray diagnosis; they were later found to suffer health issues such as leukaemia and abnormal chromosomes. Public interest in radioactivity had declined by the end of the 1930s.
== Medical uses == Insulin glargine/lixisenatide is approved as a prescription for adults with type 2 diabetes mellitus poorly controlled by lixisenatide or basal insulin alone. According to the American Diabetes Association, combination treatment of a GLP-1 receptor agonist with basal insulin should occur after HbA1C levels remain above target (7% for most type 2 people with diabetes) following use of basal insulin. The use of insulin glargine/lixisenatide and lixisenatide-containing products is not recommended for use while pregnant. There is insufficient data in humans to form a pregnancy risk category for lixisenatide. Animal pregnancy studies have shown potential risks to the prenate, but it is unclear if these risks are related to the drug. It is unknown if insulin glargine and lixisenatide are present in human milk or the effects these drugs would have on breastfed infants. Potential adverse effects to the mother and child as well as management of diabetes and glucose control should be considered prior to use of Soliqua during breastfeeding.
Trump's 2024 presidential campaign refused to release basic medical records on Trump's health for a significant period, with the most recent release being in 2015. A number of official reports have since been made, concluding that Trump was in "excellent health" and "fully fit" to serve as president. Beginning in 2025, concerns grew over Trump's stamina after he appeared to fall asleep during multiple meetings. By May 2026, multiple polls showed a majority of Americans did not believe Trump was mentally fit to be president. Overall concerns have continued to abound throughout his second presidency, with both Trump insiders and outside critics directly discussing supposed health risks and their future impacts, up to and including a presidential succession by Vice President JD Vance.
Sources: en.wikipedia.org
=== Music === Morgan Freeman's Symphonic Blues Experience released their first album in 2026 with guest appearances by Keb’ Mo’, Shemekia Copeland, Anthony "Big A" Sherrod, the Chineke! Orchestra, Lady Adrena and others. The first single from the album, "Death Letter Blues," featured Grammy-winner Taj Mahal.
== Generation == PAW is produced through the generation of plasma inside the water to generate the required ions. The interaction between cold atmospheric plasma (CAP) and water modifies the liquid chemical properties through the production of reactive oxygen and nitrogen species (RONS). RONS thus generated fall into two macro groups: long-lived species such as hydrogen peroxide (H2O2), nitrites (NO2−), nitrates (NO3−), ozone (O3), and short-lived species such as hydroxyl radicals (OH·), nitric oxide (NO), superoxide (O2−), and peroxynitrous acid (ONOOH).
== Further reading == Aarhus, R.; Aarhus, R (1995). "A Derivative of NADP Mobilizes Calcium Stores Insensitive to Inositol Trisphosphate and Cyclic ADP-ribose". Journal of Biological Chemistry. 270 (5): 2152–7. doi:10.1074/jbc.270.5.2152. PMID 7836444.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
Sources: en.wikipedia.org
It acts upstream at the pituitary receptor and depends on functioning somatotroph cells to produce any effect. Growth hormone injections bypass that step and deliver the hormone directly. The pharmacokinetic profiles and the resulting feedback on the body's own secretion therefore differ.
Insulin-like growth factor 1 is a downstream product of growth hormone action and changes more slowly than the hormone itself. Its blood concentration is used as an integrated indicator of whether the pathway has been stimulated. Interpretation requires attention to nutrition, illness, and other factors that shift IGF-1 independently.
No. The approved indication concerns excess visceral abdominal fat in adults with HIV infection and lipodystrophy, a specific clinical population. It is not cleared for general weight reduction or for cosmetic use. Studies in other groups remain investigational.
It is a laboratory-made peptide of forty-four amino acids whose sequence matches human growth hormone-releasing hormone, with a modified amino terminus. The modification is a short unsaturated fatty acid chain attached to the first residue. This change slows enzymatic breakdown and lengthens the time the peptide stays active in circulation.